Protein Info for RR42_RS14720 in Cupriavidus basilensis FW507-4G11

Annotation: RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 PF00270: DEAD" amino acids 84 to 270 (187 residues), 156.3 bits, see alignment E=9.6e-50 PF00271: Helicase_C" amino acids 310 to 418 (109 residues), 107.4 bits, see alignment E=7.5e-35

Best Hits

KEGG orthology group: None (inferred from 78% identity to reh:H16_A2699)

Predicted SEED Role

"ATP-dependent RNA helicase NGO0650" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBQ9 at UniProt or InterPro

Protein Sequence (646 amino acids)

>RR42_RS14720 RNA helicase (Cupriavidus basilensis FW507-4G11)
MTQHDIRAEQDFASAADASIEAAAIATPAIQEPSPLDKLDAILSPEAAVAPAAVAINAEN
GFAKLGLEEAILRALVELNYTTPTPVQAQAIPAFLAGRDLLVSSQTGSGKTGAFILPAIQ
RISEKASPNRPRSDDPVKRMKGKRPRPSPAQPALLVLTPTRELALQVTEATAKYGRHLRR
IVCASILGGMPYPKQLAALSKMPDILVATPGRLLDHVEAGRIDLSQLDMLVFDEADRMLD
MGFADDIDAIVAATPATRQTLMFSATLDGRIAQLASRQLRDPQRIEIAATRADQSNIEQR
LHFTDDMSHKEKLLDHLLRDTTLKQAIVFTATKRDADSLAERLSDTGFAAGALHGDMTQG
ARNRTLTSLRRGNLRILVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRS
GVAINLVNHGDMFQWKRIERFTNNRVDASVIEGLEPRRSPKPRSGFAGKPGGDRGGYRGN
SNGGGYRGGENRSFGDRKFGGGESRGFGSRDGAPRPAGDRPFGDRDGNRGFGDRSSLGNP
NGNSTGYRGQGAAGGQRSFNNEGGYRGGDNRGFGNRDGAAPRSFGDGNRGGFGGGAAGNG
GNGGYRGGEGRSFGNRDGNREGAPRSFGGGQRNGNGNTGGRSRFER