Protein Info for RR42_RS14600 in Cupriavidus basilensis FW507-4G11

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF02798: GST_N" amino acids 2 to 81 (80 residues), 28.4 bits, see alignment E=4.4e-10 PF13417: GST_N_3" amino acids 9 to 86 (78 residues), 28.1 bits, see alignment E=5.1e-10 PF13409: GST_N_2" amino acids 10 to 83 (74 residues), 40.3 bits, see alignment E=9.9e-14 PF00043: GST_C" amino acids 127 to 203 (77 residues), 33.4 bits, see alignment E=1.1e-11 PF13410: GST_C_2" amino acids 134 to 198 (65 residues), 33 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 82% identity to reu:Reut_A2351)

Predicted SEED Role

"Uncharacterized glutathione S-transferase-like protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4P1 at UniProt or InterPro

Protein Sequence (214 amino acids)

>RR42_RS14600 glutathione S-transferase (Cupriavidus basilensis FW507-4G11)
MLRIWGRLSSINVQKVVWCARELHLDHERIDIGVSEGDLDTEAYVRLNPDRSIPVIEDFR
GTDVGGEPFVLWESNAIVRYLCAHDGEDTLWPGNVKARALADRWMDWQTNAFSPAMVDAF
RHLVRLPAEQRDPDLIARSLERTEPLAARLDEALAQREFICGDRFTMADIPVACAAHRWL
GLPVTHQPRPHLERWAAAMRARPAARTILTLPLV