Protein Info for RR42_RS14455 in Cupriavidus basilensis FW507-4G11

Annotation: succinate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 65 to 96 (32 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 8 to 129 (122 residues), 116.3 bits, see alignment E=4.6e-38 PF01127: Sdh_cyt" amino acids 18 to 127 (110 residues), 79 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 88% identity to cti:RALTA_A2131)

MetaCyc: 34% identical to succinate dehydrogenase membrane b556 subunit (Pseudomonas putida KT2440)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4L8 at UniProt or InterPro

Protein Sequence (135 amino acids)

>RR42_RS14455 succinate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MAEAKQARPEFRNIHVTQLARYRLPWAGKVSILHRASGALMFLLLPFILYLFEQSVTSEL
SFAKFSALLSGGFVKLVLLALIWGYLHHFCAGIRFLLLDVHVGVTKPASAKSAVAVLVIS
LLLTAVFGLKLFGLF