Protein Info for RR42_RS14450 in Cupriavidus basilensis FW507-4G11

Annotation: succinate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details PF01127: Sdh_cyt" amino acids 3 to 107 (105 residues), 66.3 bits, see alignment E=1.4e-22 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 15 to 119 (105 residues), 133.1 bits, see alignment E=2.1e-43

Best Hits

Swiss-Prot: 42% identical to DHSD_COXBU: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 96% identity to cti:RALTA_A2130)

MetaCyc: 36% identical to succinate:quinone oxidoreductase, membrane protein SdhD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YHW5 at UniProt or InterPro

Protein Sequence (121 amino acids)

>RR42_RS14450 succinate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MANNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTIVLAVAFLLSNGASYEAWAGLFSN
QWMKIITFLTILSLLYHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAAQILWR
V