Protein Info for RR42_RS14365 in Cupriavidus basilensis FW507-4G11

Annotation: N-(5'-phosphoribosyl)anthranilate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00697: PRAI
  • amino acids 16 to 225 (210 residues), 144.9 bits, E=1.3e-46

Best Hits

Swiss-Prot: 73% identical to TRPF_RALPJ: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 84% identity to reu:Reut_A2307)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of chorismate metabolism (45/59 steps found)
• L-tryptophan biosynthesis (6/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.24

Sequence Analysis Tools

See A0A0C4YBK0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS14365 N-(5'-phosphoribosyl)anthranilate isomerase (Cupriavidus basilensis FW507-4G11)
MTLLPEAGSVPRRTRIKICGLTREEDVRAAVDAGADAIGLVFYPGSPRFVEVARAAALAE
AAGPFVSVVGLFVNAEADHIAHVVERVPLTLLQFHGDERPEDCTLVAQRCRLPFLRAARV
QPGLDLVEFADLHRDAAALLLDAFVEGYGGGGHVFDWTLIPPTWLAPTHNPTASAAPRIV
LSGGLNAQNVAGAIERVRPYAVDVSSGVEAAKGVKDHARIAAFVRAVRSADAG