Protein Info for RR42_RS14295 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR01288: nodulation ABC transporter NodI" amino acids 5 to 303 (299 residues), 479.4 bits, see alignment E=1.8e-148 PF00005: ABC_tran" amino acids 20 to 164 (145 residues), 121.3 bits, see alignment E=5e-39 PF13304: AAA_21" amino acids 127 to 193 (67 residues), 40.9 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 90% identical to NODI_CUPNJ: Nod factor export ATP-binding protein I (nodI) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09695, lipooligosaccharide transport system ATP-binding protein (inferred from 91% identity to cti:RALTA_A2101)

Predicted SEED Role

"Nodulation ABC transporter, NodI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YDY4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>RR42_RS14295 ABC transporter ATP-binding protein (Cupriavidus basilensis FW507-4G11)
MTAILELRNVSKQYGDTVVVDDLSLSVQRGQCFGLLGPNGAGKTTTLRLLLGLTTPASGT
LTLCGEPIPQRAPQARMRVGVVPQFDNLDPDFTVVENLRIFGRYFGLERAVIEARVPALL
EFARLESRAKAQVRDLSGGMRRRLTVARALINDPDLLVMDEPTTGLDPQARHLIWERLKS
LLANGKTILLTTHFMEEAERLCNYLCVIDSGRKIAEGKPHELIDSQIGCDVVEVYGDNLE
PLRGELHPLATRTEMSGETLFCYVKEPAPLLAALHGRSGVRYLHRPANLEDVFLKLTGRE
MRD