Protein Info for RR42_RS14205 in Cupriavidus basilensis FW507-4G11

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR01514: nicotinate phosphoribosyltransferase" amino acids 2 to 387 (386 residues), 482.8 bits, see alignment E=4.4e-149 PF17767: NAPRTase_N" amino acids 7 to 128 (122 residues), 131.3 bits, see alignment E=2.5e-42 PF04095: NAPRTase" amino acids 164 to 388 (225 residues), 268.1 bits, see alignment E=8e-84

Best Hits

Swiss-Prot: 86% identical to PNCB_CUPNH: Nicotinate phosphoribosyltransferase (pncB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 86% identity to reh:H16_A2589)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBH7 at UniProt or InterPro

Protein Sequence (392 amino acids)

>RR42_RS14205 nicotinate phosphoribosyltransferase (Cupriavidus basilensis FW507-4G11)
MIITSLLDTDLYKFTMMQVVLHHFPAAQVEYRFKCRNAGVDLTPYVDEIREEVAQLCQVR
FTPDELQYLRELRFIKSDFVDFLDLFHLNEKYVTIAPAAPGSGEIEITIRGPWLHTILFE
VPLLAIVNEVYFRRTQPQPDWSEGRKRLEDKLALLKMPAHADCVIADYGSRRRFSRDWQE
EVLQTMRRVLGPQLAGSSNVHFARTHNLVPLGTMAHEYLQACQALGPRLRDSQVFALEVW
AKEYRGDLGIALSDTYGFDAFLRDFDLYFCKLFDGVRHDSGDPIAWGERMLAHYAAGRVD
PQGKTLIFSDSLDIPRVIELYERFGGRCRLAFGVGTNLTNDLGYTPLQIVIKMTRCNGQP
VAKLSDTPEKTMCDDPAYLAYLRQVFGIKAPA