Protein Info for RR42_RS14000 in Cupriavidus basilensis FW507-4G11

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 TIGR00194: excinuclease ABC subunit C" amino acids 28 to 301 (274 residues), 316.5 bits, see alignment E=1.8e-98 PF01541: GIY-YIG" amino acids 36 to 110 (75 residues), 33.7 bits, see alignment E=9.1e-12 PF02151: UVR" amino acids 221 to 253 (33 residues), 32.1 bits, see alignment (E = 1.7e-11) PF22920: UvrC_RNaseH" amino acids 269 to 307 (39 residues), 36.7 bits, see alignment 8.7e-13 amino acids 350 to 422 (73 residues), 63.2 bits, see alignment E=5.4e-21 PF08459: UvrC_RNaseH_dom" amino acids 449 to 619 (171 residues), 153.7 bits, see alignment E=1e-48 PF14520: HHH_5" amino acids 634 to 685 (52 residues), 29.7 bits, see alignment 1.8e-10

Best Hits

Swiss-Prot: 81% identical to UVRC_CUPMC: UvrABC system protein C (uvrC) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 82% identity to cti:RALTA_A2048)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBI7 at UniProt or InterPro

Protein Sequence (686 amino acids)

>RR42_RS14000 excinuclease ABC subunit C (Cupriavidus basilensis FW507-4G11)
MPEQLAKASLAAPADSVSDAPFDAKAVIAQLPGLPGVYRYFDAQGNVLYVGKARDLKKRV
SSYFNKTLLSPRIAMMVAKIVRIDTTVVRTEAEALLLENNLIKALAPRYNILFRDDKSYP
FVKLTSHRFPRMAYYRGATDRKHQYFGPFPSAGAVRESMQILQRVFQLRTCEDTVFTNRT
RPCLLHQIHRCTGPCVGAISEADYMRDVSNAARFLQGRQNEVLEGLQAKMEEHAGRLEFE
QAAAVRDQIGALSTVLKRQAVEEVGQSSDIDVLAVAVEGGRACVNLAMVRGGRHLGDKAY
FPAHVEEGAMIVGHRDEDAGASAVTEPGEAGGEGAAAPGGPAGIPVERIAAEVLSAFLAQ
HYLDQAVPPILVVSHLPPGKALLEALSMQAGRKVTLVRQPQGQRRSWLEMAQKGAELALS
RRLAEQGSQQARTRALAETIGIDMEDLALLRVECFDISHTAGEATQASCVVFHHHEMQNA
EYRRYNIQDITPGDDYAAMRQVLTRRYQKLVEMLEQAQEAAPGGDEQGREAGASSALALV
PNVVLIDGGKGQVEVARQVFEELGLDIGLLVGVAKGEGRKVGLETLIFADGRPSLELGQG
SAALMLVAQIRDEAHRFAITGMRARRAKVRNTSRLEEIEGVGARRRQKLLTRFGGLRGVV
AASIDELASVDGISHALAEEIYRQLH