Protein Info for RR42_RS13970 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 49 (17 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 344 to 369 (26 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 393 (381 residues), 240.2 bits, see alignment E=1.7e-75

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 87% identity to reh:H16_A2542)

Predicted SEED Role

"TrkA-N:Sodium/hydrogen exchanger" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4F8 at UniProt or InterPro

Protein Sequence (409 amino acids)

>RR42_RS13970 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MHHATPLISTIVGGLVLAFILGALANRLKLPPLIGYLCAGIVVGPYTPGYTADQALAPEL
AELGVILLMFGVGLHFSLKDLMAVKTIAIPGAVVQIGIATLLGMGAAWGFGWEWGPGLVF
GLALSVASTVVLLKALQERELVESPQGRIAVGWLIVEDLAMVLTLVLLPALAGLLTPSAD
GAASGAAAPDSGDIVFAVFATLGKVAAFVAVMLVIGRRFIPWMLERIVWTGSRELFRLAV
LATALGVAFGAYSLFGVSFALGAFFAGMVLAESEFSHRAAEESLPLRDAFAVLFFVSVGM
LFNPMVLINDPWGVLATLFIIVVGKSLAALCIVRVFGHSTRTGMTIAVSLAQIGEFSFIL
AGLGVYLKILPERGHALILAGALLSIVLNPLLFHLLDRYTAKHAGEADP