Protein Info for RR42_RS13415 in Cupriavidus basilensis FW507-4G11

Annotation: translation initiation factor IF-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00008: translation initiation factor IF-1
  • amino acids 3 to 71 (69 residues), 101.8 bits, E=7.6e-34
• PF01176: eIF-1a
  • amino acids 8 to 70 (63 residues), 83.2 bits, E=4e-28

Best Hits

Swiss-Prot: 100% identical to IF11_CUPMC: Translation initiation factor IF-1 1 (infA1) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 99% identity to reu:Reut_A2156)

Predicted SEED Role

"Translation initiation factor 1"

Sequence Analysis Tools

See A0A0C4Y468 at UniProt or InterPro

Protein Sequence (73 amino acids)

>RR42_RS13415 translation initiation factor IF-1 (Cupriavidus basilensis FW507-4G11)
MAKEELIEFGGVVSEALPDNRYRVTLENGVEIWAYASGKMQKHRIRILAGDRVTLEMSPY
DLTKGRINFRHKV