Protein Info for RR42_RS13375 in Cupriavidus basilensis FW507-4G11

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 201 to 228 (28 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details PF12911: OppC_N" amino acids 17 to 54 (38 residues), 35.4 bits, see alignment 7.8e-13 PF00528: BPD_transp_1" amino acids 170 to 351 (182 residues), 102.9 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 52% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 90% identity to cti:RALTA_A1951)

MetaCyc: 52% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB33 at UniProt or InterPro

Protein Sequence (375 amino acids)

>RR42_RS13375 peptide ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MKFSSRALPNGLPHSLSPRQRAWQRFRRNRLGYWSLILFVAIFLLSMVAETLSSDRPLVV
KYKGEWYFPIVKTYAESTFDGDFPTKADYLDPFIRDRITSNGNFAIFPPNRYSYDSINYF
SKEPNPAPPSAENWLGTDDRGRDVLARLLYGFRVSVLFSLALTLIGVVIGTLTGALMGFF
GGRFDLISQRAIEIWSSMPELYLLIIFASIFTPSLALLIILLSLFGWMGLSDYVRAEFYR
NRSLDYVKAARALGLSNVQIMWRHILPNSLTPVITFLPFRMSAAILALTSLDFLGLGVPP
TTPSLGELLAQGKANLDAWWISLSTFAVLVVTLLLLTFMGDALRDAFDTRLGLAQLRGRV
EPKAPEGSPAAEAAS