Protein Info for RR42_RS13325 in Cupriavidus basilensis FW507-4G11

Annotation: 50S ribosomal protein L31

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF01197: Ribosomal_L31" amino acids 1 to 78 (78 residues), 97.9 bits, see alignment E=1.6e-32 TIGR00105: ribosomal protein bL31" amino acids 1 to 79 (79 residues), 77.5 bits, see alignment E=3.3e-26

Best Hits

Swiss-Prot: 89% identical to RL31B_CUPNJ: 50S ribosomal protein L31 type B (rpmE2) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 89% identity to reu:Reut_A2120)

Predicted SEED Role

"LSU ribosomal protein L31p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAY5 at UniProt or InterPro

Protein Sequence (87 amino acids)

>RR42_RS13325 50S ribosomal protein L31 (Cupriavidus basilensis FW507-4G11)
MKEGIHPNYREVVFLDVSNDFSFVTRSTIQTRDTITRDGKEYPLAKIEVSSESHPFYTGT
QKIMDTAGRVEKFRQKFGSKLNKLTAK