Protein Info for RR42_RS13185 in Cupriavidus basilensis FW507-4G11

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 110 to 391 (282 residues), 450.3 bits, see alignment E=3e-139 PF00140: Sigma70_r1_2" amino acids 118 to 150 (33 residues), 24.8 bits, see alignment 3.7e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 152 to 380 (229 residues), 120 bits, see alignment E=7.8e-39 PF04542: Sigma70_r2" amino acids 156 to 225 (70 residues), 77.5 bits, see alignment E=1.1e-25 PF04539: Sigma70_r3" amino acids 236 to 312 (77 residues), 45.3 bits, see alignment E=1.5e-15 PF04545: Sigma70_r4" amino acids 326 to 378 (53 residues), 60.4 bits, see alignment 1.9e-20

Best Hits

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 88% identity to reh:H16_A2373)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y435 at UniProt or InterPro

Protein Sequence (392 amino acids)

>RR42_RS13185 RNA polymerase sigma factor RpoS (Cupriavidus basilensis FW507-4G11)
MPRQKTVSTGSTSRARHPKQPELPQSTGVAQADADADSEAYGQDPAADLVPLTDEPITTG
TAVGLREADLMVEEVERQARDEDEEESEDEEEGEAAAEPAAPDHDDFRTVLHTELAADTV
QHYLNRISIKPLLSAPEELHFSTLAKGGDFSARQVMIERNLRLVVSIAKGYLNRGVPLLD
LIEEGNLGLMHAIEKFDPSRGFRFSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQV
LRAKRHLEKGGTDGRDASLEDIAHLLGKTPDEIQDVLALNEHTTSLDTPFDLDPGSSLLD
FLSDEHNAAPDQEVAHRELENLMKQWLARLSEKHRYVVERRFGLNHIEPATLEELAEEMG
LTRERVRQIQQEALVKLKRHFASQGVRKDAVL