Protein Info for RR42_RS13165 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 23 to 225 (203 residues), 164 bits, see alignment E=2.1e-52

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 92% identity to reu:Reut_A2091)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAU6 at UniProt or InterPro

Protein Sequence (233 amino acids)

>RR42_RS13165 membrane protein (Cupriavidus basilensis FW507-4G11)
MDNKLNTYSFGSGTATSDVVVRNRVMRNTYWLLAISMIPTVIGAWIGVTTGFSLMKGSPG
LSMILFLGIAFGFFYAIEKTKNSSMGVVLLLAFTFFMGLMLSRLIGSVLQFSNGPALIMY
AFGGTAAVFGAMATIATVSKRDFSGLSKFLFVGVILLILASVANIWLQLPSLMITVSVIA
IGIFSAYILFDVQRVLNGGETNYITATLAIYLDVYNVFANLLALLGIFGGNRD