Protein Info for RR42_RS13140 in Cupriavidus basilensis FW507-4G11

Annotation: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR00612: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase" amino acids 16 to 409 (394 residues), 393.4 bits, see alignment E=5e-122 PF04551: GcpE" amino acids 31 to 410 (380 residues), 382.4 bits, see alignment E=9.4e-119

Best Hits

Swiss-Prot: 87% identical to ISPG_RALPJ: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (ispG) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03526, (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC: 1.17.7.1] (inferred from 91% identity to cti:RALTA_A1909)

Predicted SEED Role

"1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1)" in subsystem Isoprenoid Biosynthesis (EC 1.17.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAT8 at UniProt or InterPro

Protein Sequence (430 amino acids)

>RR42_RS13140 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (Cupriavidus basilensis FW507-4G11)
MNQQACMPVLPGPLPRRKTRQARVVWGDNVVTIGGDAPVRVQSMTNTDTVDAIGTAIQVK
ELARAGSEIVRITVNTPEAAAAVPALREQLDRMGVNVPLVGDFHYNGHTLLRDYPDCAQA
LSKYRINPGNVGQGAKRDTQFAQMIEMACRYDKPVRIGVNWGSLDQSLLARIMDENALRA
EPWPAQNVMVEALITSAIESAKKAEEIGLSGDQIILSCKVSQVQELIAVYRELTKRCDYA
LHLGLTEAGMGSKGIVASTAALSVLLQEGIGDTIRISLTPEPGAAREKEVYVGQEILQTM
GLRNFTPMVIACPGCGRTTSTTFQELASSIQSYLREQMPTWKTAYPGVEEMDVAVMGCIV
NGPGESKHANIGISLPGSGESPAAPVFVDGVKVKTLRGDRIAEEFQAIVDDYVRTHYGNK
AGSAGNEVAA