Protein Info for RR42_RS13120 in Cupriavidus basilensis FW507-4G11

Annotation: ribosome-associated GTPase EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 436 (434 residues), 560.9 bits, see alignment E=3.2e-172 TIGR00231: small GTP-binding protein domain" amino acids 4 to 157 (154 residues), 60.6 bits, see alignment E=2.4e-20 amino acids 180 to 342 (163 residues), 88.6 bits, see alignment E=5.8e-29 PF02421: FeoB_N" amino acids 5 to 122 (118 residues), 36.5 bits, see alignment E=1.2e-12 amino acids 182 to 345 (164 residues), 42.5 bits, see alignment E=1.8e-14 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 91.9 bits, see alignment E=1.1e-29 amino acids 182 to 300 (119 residues), 93.1 bits, see alignment E=4.3e-30 PF00009: GTP_EFTU" amino acids 181 to 349 (169 residues), 38.6 bits, see alignment E=3.2e-13 PF14714: KH_dom-like" amino acids 356 to 436 (81 residues), 92.6 bits, see alignment E=5.1e-30

Best Hits

Swiss-Prot: 92% identical to DER_CUPMC: GTPase Der (der) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03977, GTP-binding protein (inferred from 91% identity to reh:H16_A2360)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YD57 at UniProt or InterPro

Protein Sequence (447 amino acids)

>RR42_RS13120 ribosome-associated GTPase EngA (Cupriavidus basilensis FW507-4G11)
MKPVIALVGRPNVGKSTLFNRMTRSRDALVADLPGLTRDRHYGEGRIGERPFIAIDTGGF
EPVAKEGIVAEMAKQTRQAVVEADVVIFLVDGRLGLAPQDRVIADYLRKTGRRVMLAVNK
AEGMKYTTVVSEFYELGMGDPYAISSTHGDGVRELVDEALELAVKERPELAEEDEGAQRG
VKIAIVGRPNVGKSTLVNTLIGEERVIAFDMPGTTRDAIYVEFERGGKPYTLIDTAGLRK
RGKVFEAIEKFSVVKTLQSIADANVVVLLLDAQQDVSEQDAHIAGFIVESGRALVVGVNK
WDGLDGHSRDRIKHDLERKLQFLDFANFHFVSAQQRTGISALLRSVDDAYAAAMVKLPTP
QLTRILQEAVEFQQPRRVGATRPKLRYAHQGGSNPPIIIVHGNSLSGIADTYRRYLENRF
RSAFKLKGTPLRIEFRTNKNPYADSKD