Protein Info for RR42_RS12970 in Cupriavidus basilensis FW507-4G11

Annotation: glycerol-3-phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 41 to 339 (299 residues), 109.6 bits, see alignment E=3.3e-35 PF13416: SBP_bac_8" amino acids 44 to 368 (325 residues), 133 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 62% identical to UGPB_PECAS: sn-glycerol-3-phosphate-binding periplasmic protein UgpB (ugpB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05813, sn-glycerol 3-phosphate transport system substrate-binding protein (inferred from 92% identity to reu:Reut_A2052)

MetaCyc: 60% identical to sn-glycerol 3-phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAP5 at UniProt or InterPro

Protein Sequence (438 amino acids)

>RR42_RS12970 glycerol-3-phosphate ABC transporter substrate-binding protein (Cupriavidus basilensis FW507-4G11)
MTVKRTALTLAAFAMLTGAGSANAAVEIQWWHSMEGALNEKVNAIATQFNASQSDYKIVP
IYKGQYDESLAAGIAAFRSGNAPAILQVFEVGTATMMSAKGAIKPVATVMKDAGEKFDAK
MYIPAVAGYYTSNKGEMLSFPFNSSTTVMYYNKDAFKKAGLDPNKPPVTWQEVATDSAKL
KAAGISCGYTTDWQSWVQLESFSAWHNVLFATENNGFGGTGARLVFNSPLHVKHIANLLD
MQQKGYFVYGGRKDEPKAKFIAGQCAMLTGSSAALANIRKNAKFDFTVAQLPYEQGVPGA
PQNTIIGGASLWVMGGKKAEEYKGVAKFFTYLSRPEVQADWHQSTGYLPVTTAAYELTKK
SGFYEKNPGADVAVKQMIVKTTDKSRGIRLGNFPQIRTVIDEELEAVWTGKKQPKEALDS
AVARGNELLERFQKTVRE