Protein Info for RR42_RS12890 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome C oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 52 to 478 (427 residues), 496.3 bits, see alignment E=4e-153 PF12801: Fer4_5" amino acids 106 to 147 (42 residues), 38.7 bits, see alignment 2.8e-13 PF13746: Fer4_18" amino acids 230 to 336 (107 residues), 145 bits, see alignment E=3.9e-46 PF11614: FixG_C" amino acids 371 to 496 (126 residues), 90.3 bits, see alignment E=3.6e-29

Best Hits

KEGG orthology group: None (inferred from 85% identity to reu:Reut_A2037)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3Z2 at UniProt or InterPro

Protein Sequence (499 amino acids)

>RR42_RS12890 cytochrome C oxidase (Cupriavidus basilensis FW507-4G11)
MNAPGPEPLERNGAAWAPLRAPTPDSADAETSDETLYEVRRKIYPRSVSGAFSSWRVWMV
VLTQLFFYGMPWLQWNGRQAMLFDLGARKFYIFGLVLWPQDVIYLAVLLVISAVSLFLFT
AIAGRLFCGYACPQTVYTEIFMWIERHVEGDRFARIRLDGDPWSARKLRLKATKHTLWIV
IALWTGFTFVGYFSPIRTLGAQVLSLSLGPWQTFWMLFYSFATWGNAGFMREQVCKYMCP
YARFQSVMVDRDTYVVTYDVGRGEPRGSRSRKADHKAAGLGSCVNCSICVQVCPTGIDIR
DGLQYDCIGCGACIDACNQVMDKMAYPRGLIRYTSENAMRSALSETVARKRLVRPRTVIY
SLIWLALVAGFMVSLAMRTPLKVDIIRDRGALGREVEGRWIENVYRLQLINTTEAPMRVA
VSAGSDELKGLVVEYDHAAGNLEPTSNRLIPVRVRVPIESAAQGTHKIEVTVTAVPDEGA
GSHGAEIRQSTSFIVPRNL