Protein Info for RR42_RS12810 in Cupriavidus basilensis FW507-4G11

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF00009: GTP_EFTU" amino acids 4 to 195 (192 residues), 188 bits, see alignment E=3.3e-59 TIGR00231: small GTP-binding protein domain" amino acids 5 to 139 (135 residues), 80.8 bits, see alignment E=9.7e-27 TIGR01394: GTP-binding protein TypA/BipA" amino acids 5 to 600 (596 residues), 936.6 bits, see alignment E=4.9e-286 PF01926: MMR_HSR1" amino acids 8 to 129 (122 residues), 24.7 bits, see alignment E=5.4e-09 PF03144: GTP_EFTU_D2" amino acids 219 to 290 (72 residues), 31.7 bits, see alignment E=4.4e-11 PF00679: EFG_C" amino acids 397 to 477 (81 residues), 78.3 bits, see alignment E=9.5e-26 PF21018: BipA_C" amino acids 486 to 594 (109 residues), 160.4 bits, see alignment E=2.8e-51

Best Hits

Swiss-Prot: 64% identical to TYPA_HAEIN: GTP-binding protein TypA/BipA homolog (typA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06207, GTP-binding protein (inferred from 96% identity to reh:H16_A2294)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAL3 at UniProt or InterPro

Protein Sequence (606 amino acids)

>RR42_RS12810 GTP-binding protein (Cupriavidus basilensis FW507-4G11)
MTRAIRNIAIIAHVDHGKTTLVDQLLRQAGTFRDNQQMVERVMDSNDIEKERGITILAKN
CAVEYNGTHINIVDTPGHADFGGEVERVLSMVDGVLLLVDAVEGPMPQTRFVTRKALALG
LKPIVVINKVDRPGARPEWVINQTFDLFDKLGATDEQLDFPVIYASGLNGYAGLTDDVRE
GDMKPLFETVLAKVPVRDDNPDGPLQLQIISLDYNSYVGKIGVGRISRGRARSLQDVVVK
FGPEGNPIKGRINQVLKFQGLEREIVAEAEAGDIVLINGIEELGIGCTVCAPDAQDALPM
LKVDEPTLTMNFCVNTSPLAGREGKFVTSRQLRERLDRELKSNVALRVAETGDDTIFEVS
GRGELHLTILLENMRREGYELAVSRPRVVFKEIDGVKHEPYELLTVDVEDGHQGSVMEEL
GRRKGELLDMASDGKGRTRLEYRVPARGLIGFQGEFLTLTRGTGLISHIFDDYAPLREGG
LGERHNGVLISQDDGDAVAYALWKLQDRGRMFVKPGDALYEGMIIGIHSRDNDLVVNPIK
GKQLTNVRASGTDEAVRLVTPIQMSLEYAVEFIADDELVEITPKSIRLRKRHLKEHERKR
ASRESV