Protein Info for RR42_RS12585 in Cupriavidus basilensis FW507-4G11

Annotation: DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00772: DnaB" amino acids 16 to 117 (102 residues), 121.6 bits, see alignment E=2.1e-39 TIGR00665: replicative DNA helicase" amino acids 16 to 452 (437 residues), 593.5 bits, see alignment E=1.2e-182 PF03796: DnaB_C" amino acids 196 to 451 (256 residues), 370.2 bits, see alignment E=7.5e-115 PF13481: AAA_25" amino acids 211 to 374 (164 residues), 51.3 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 56% identical to DNAB_ECO57: Replicative DNA helicase (dnaB) from Escherichia coli O157:H7

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 96% identity to reh:H16_A2275)

MetaCyc: 56% identical to replicative DNA helicase (Escherichia coli K-12 substr. MG1655)
RXN0-4261 [EC: 5.6.2.3]

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12 or 5.6.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCR9 at UniProt or InterPro

Protein Sequence (463 amino acids)

>RR42_RS12585 DNA helicase (Cupriavidus basilensis FW507-4G11)
MNAPVADPQLDNLKVPPHSIEAEQSVLGGLLLDNAAWDRIADFLNEADFYRFDHRMIFQS
ISRLIAATKPADVITVYESLQGAGKAEEVGGLAYLNSLAQNTPSAANIRRYAEIVRERSV
LRKLVTVADDIATAAFAPKGREVRELLDEAESKVFAIAEEGSRGQKGFQEIQPLLTQVVE
RIDELYHRDSSTDVTGVPTGFIDLDRMTSGMQAGDLIIVAGRPSMGKTAFSLNIGEHVAV
EQGLPVAVFSMEMAGTQLAMRMLGSVGRLDQHRLRTGRLLDEDWPRLTHAIQRMNDAQLF
IDETPALSSMELRARSRRLARQCGQLGLIVIDYLQLMSGSGGGENRATEISEISRSLKGL
AKELNCPVIALSQLNRSLEQRPNKRPVMSDLRESGAIEQDADVILFIYRDEVYNPDSQDK
GTSEIIIGKQRNGPIGTVRLTFLGQFTKFDNFSGGPAFFDNDN