Protein Info for RR42_RS12575 in Cupriavidus basilensis FW507-4G11

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 49 to 71 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 139 to 165 (27 residues), see Phobius details amino acids 200 to 209 (10 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details PF01384: PHO4" amino acids 25 to 325 (301 residues), 315.5 bits, see alignment E=2.2e-98

Best Hits

Swiss-Prot: 63% identical to PIT_RHIME: Probable low-affinity inorganic phosphate transporter (pit) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 94% identity to reu:Reut_A2000)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3U5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>RR42_RS12575 inorganic phosphate transporter (Cupriavidus basilensis FW507-4G11)
MQTIQMSLWVIGLLVALALLFDFMNGFHDAANSIATVVSTGVLKPHHAVAMAAMCNVVAI
FIFHLKVAATVGTGTIDVNIVDHYVIFGALMGAIAWNLITWYYGIPSSSSHALIGGLVGA
AVAKSGTSALVGGGLLKTVAFIVISPLLGFLLGSLMMVIVAWTFFRTPPSRVDRWFRRLQ
LVSASLYSLGHGGNDAQKTIGIIWMLLIASGHVAQGGAEPPIWVIVSCYVAIGMGTMFGG
WRIVRTMGQKITKLKPVGGFCAETGGAITLFIASALGVPVSTTHTITGAIVGVGSVQKMS
AVRWGVAGNIVWAWVLTIPASAFMAAIAWWIGRHIL