Protein Info for RR42_RS12540 in Cupriavidus basilensis FW507-4G11

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01408: GFO_IDH_MocA
  • amino acids 4 to 127 (124 residues), 28.9 bits, E=3.3e-10
• PF03447: NAD_binding_3
  • amino acids 10 to 129 (120 residues), 80.5 bits, E=3.2e-26
• PF00742: Homoserine_dh
  • amino acids 137 to 315 (179 residues), 220 bits, E=4e-69
• PF01842: ACT
  • amino acids 354 to 421 (68 residues), 49.8 bits, E=4.6e-17

Best Hits

Swiss-Prot: 66% identical to DHOM_PSEAE: Homoserine dehydrogenase (hom) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 92% identity to rme:Rmet_1966)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A0A0C4YAF0 at UniProt or InterPro

Protein Sequence (436 amino acids)

>RR42_RS12540 homoserine dehydrogenase (Cupriavidus basilensis FW507-4G11)
MNPIKVGLLGIGTVGSGTFNVLQRNQEEIRRRAGRGIEIAMVADLNTERARELTGGQVEV
VADANEVVTRPEIDIVIELIGGYGIARELVLKAIENGKHVVTANKALLAVHGNEIFEAAR
KKGVIVAFEAAVAGGIPIIKALREGLTANRIEWIAGIINGTTNFILSEMRDKGLDFGTVL
KQAQALGYAEADPTFDIEGIDAAHKITLMSSIAFGMPVQFDKAYVEGITKLSAVDIRYAE
ELGYRIKLLGLTRRRENGIELRVHPTLVPAKRLIANVEGAMNAVLVQGDAVGATLYYGKG
AGAEPTASAVIADLVDVTRLHTADPEHRVPHLAFQPDELSSVPVLPIEEVTSSYYLRMRV
ADEAGVLADITRILADAGISIDAMLQKESREGEPQTDIIMLSHLTLEKQVNAAIAKIEAL
PTVLSAVTRLRMEELN