Protein Info for RR42_RS12530 in Cupriavidus basilensis FW507-4G11

Annotation: molybdenum cofactor biosynthesis protein MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 311 to 326 (16 residues), see Phobius details PF03453: MoeA_N" amino acids 14 to 173 (160 residues), 156.4 bits, see alignment E=7.7e-50 TIGR00177: molybdenum cofactor synthesis domain" amino acids 183 to 324 (142 residues), 85.9 bits, see alignment E=1.3e-28 PF00994: MoCF_biosynth" amino acids 186 to 326 (141 residues), 107.6 bits, see alignment E=6.9e-35 PF03454: MoeA_C" amino acids 342 to 406 (65 residues), 38 bits, see alignment E=2.3e-13

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 88% identity to cti:RALTA_A1808)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAG9 at UniProt or InterPro

Protein Sequence (413 amino acids)

>RR42_RS12530 molybdenum cofactor biosynthesis protein MoaA (Cupriavidus basilensis FW507-4G11)
MTQAAAPARPPMLTMAQALEALLAGARPLAEAERIATLDANGRVLAAPVSSTLDVPPADN
TSMDGYAVRSADLAAPGTRLRVAQRIPAGHVGTALAAGTAARIFTGGLIPPGADAVVMQE
QCVAQGEDVIVNHTPQPGEWIRRAGEDIRAGSVILPAGTRLTPQALGLAASVGQASLDVV
RRVKVAVFFTGDELAMPGEPLKPGAIYNSNRFTLRGLLENLGCEVSDFGIVPDTLAATRD
TLRRAAEGHDLIITSGGVSVGEEDHIKPAVEAEGRLNLWQIAIKPGKPLAFGEVARAGQA
PAFFLGLPGNPVSSFVTFLLFVRPFILRLQGVQDVMPRRLPLRADFDLPKGDRRNEFLRV
RLNQAGGLDLFPNQSSGVLTSTVWGEGLVDNPPNQPIARGDTVQFIGFDGLLA