Protein Info for RR42_RS12070 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 225 to 241 (17 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 463 to 481 (19 residues), see Phobius details PF13347: MFS_2" amino acids 29 to 186 (158 residues), 40.7 bits, see alignment E=1.2e-14 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 34 to 437 (404 residues), 257.5 bits, see alignment E=1.2e-80 PF07690: MFS_1" amino acids 38 to 428 (391 residues), 150.7 bits, see alignment E=5.1e-48

Best Hits

KEGG orthology group: None (inferred from 84% identity to cti:RALTA_A1741)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YCF4 at UniProt or InterPro

Protein Sequence (489 amino acids)

>RR42_RS12070 MFS transporter (Cupriavidus basilensis FW507-4G11)
MSERPSSPAAGRQPGGPTRESLRARYGSQLRWLVLLTLMLGTVSSIVSSTIVNVAIPDLS
RHFVLGQDSAQWVAASFMIAMTLSMLLTPWLLNRYGLRRTFIGSLLLLGMGGLVGGFSPT
YGVMIAMRVAEGIAAGILQPLPNILILRVFEEREQGKAVSMFGFGVVLAPALGPSVGGFL
VEAYGWRSIFFVVVPLTLIGLWMARRFMAVDSAMMGERKPLDWQGLGLAGIATVSLLNGL
VQMRESVPAGTALAAFGVLMLVVFVLWQLRAENPLMNMRLYSYRQFSAGAVVAFIYGAGL
FGSTYLLPVYMQMALAYTPSRAGLVLLPAGIALALTIAAAGRLTHRVSPHLQVSFGLALL
SASFLLMAMGSQATPYLLLVGFAVLGRIGLGCILPSLTLGSMRGVDYSLIAQGSSCINFI
RQLGGAIGVSLAGVGLQWRLAAQGAVLGTDGDPAARIRAFDETFLAVGLVIATAILAAWR
IRPRPLAEA