Protein Info for RR42_RS12055 in Cupriavidus basilensis FW507-4G11

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 93 to 106 (14 residues), see Phobius details TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 20 to 152 (133 residues), 115.3 bits, see alignment E=1.1e-37 PF00583: Acetyltransf_1" amino acids 22 to 130 (109 residues), 49.4 bits, see alignment E=1e-16 PF13673: Acetyltransf_10" amino acids 34 to 136 (103 residues), 34.1 bits, see alignment E=5.1e-12 PF13508: Acetyltransf_7" amino acids 56 to 131 (76 residues), 33.5 bits, see alignment E=9e-12 PF08445: FR47" amino acids 75 to 133 (59 residues), 26 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 76% identity to cti:RALTA_A1738)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YGL4 at UniProt or InterPro

Protein Sequence (164 amino acids)

>RR42_RS12055 acyltransferase (Cupriavidus basilensis FW507-4G11)
MPVMPGVPAGWSLGRMTALDVEAVAQIEARAYTHPWTRANFENSVKAGHIGLTLRDNGGV
LVAYTVLMPVVDEMHLLNITVDPARQRGGLGRLLLAAAMATSHALHLHTMLLEVRPSNVG
AIELYREAGFAEIGRRKGYYPAAGQTREDALVLRRAWAPTEAVP