Protein Info for RR42_RS12035 in Cupriavidus basilensis FW507-4G11

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 4 to 358 (355 residues), 359.5 bits, E=9.5e-112
• PF01168: Ala_racemase_N
  • amino acids 9 to 217 (209 residues), 216.5 bits, E=3.8e-68
• PF00842: Ala_racemase_C
  • amino acids 232 to 357 (126 residues), 140.1 bits, E=3.2e-45

Best Hits

Swiss-Prot: 85% identical to ALR_CUPNH: Alanine racemase (alr) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 86% identity to reu:Reut_A1934)

MetaCyc: 57% identical to alanine racemase 2 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase, catabolic (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• L-alanine degradation I (2/2 steps found)
• alanine racemization (1/1 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)
• L-lysine degradation V (3/9 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cysteine metabolism
• D-Alanine metabolism
• D-Arginine and D-ornithine metabolism
• D-Glutamine and D-glutamate metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

See A0A0C4Y3L9 at UniProt or InterPro

Protein Sequence (371 amino acids)

>RR42_RS12035 alanine racemase (Cupriavidus basilensis FW507-4G11)
MPRPIHAVIHQPALANNLDVVRRCAPQSRVWAVIKANAYGHGIRRAFAGLRAADGFGLLD
LNEAVLLRELGWQGPILLLEGFFQPQDVPLLEQYRLTTAVHCEEQLRMLEVARPKGPLGI
QLKLNTGMNRLGFRPEQYRTAWERARTLPCVGSIVHMTHFSDADSARGIAHQLEVFDATT
ANLPGEASLSNSAATLWHPQAHRAWVRPGVVLYGASPTGVAADVASFGLQPAMSLHSELI
SVQDLQPGDTVGYGSLFTAERPMRIGVVACGYADGYPRHAAGWGDKPAPVLVDGVRTRLV
GRVSMDMICVDLTPCPRAKVGSAVTLWGQGLPIDDVAVASGTVGYELMCALAPRVPVTVA
TLTTPEQSALA