Protein Info for RR42_RS12035 in Cupriavidus basilensis FW507-4G11

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR00492: alanine racemase" amino acids 4 to 358 (355 residues), 359.5 bits, see alignment E=9.5e-112 PF01168: Ala_racemase_N" amino acids 9 to 217 (209 residues), 216.5 bits, see alignment E=3.8e-68 PF00842: Ala_racemase_C" amino acids 232 to 357 (126 residues), 140.1 bits, see alignment E=3.2e-45

Best Hits

Swiss-Prot: 85% identical to ALR_CUPNH: Alanine racemase (alr) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 86% identity to reu:Reut_A1934)

MetaCyc: 57% identical to alanine racemase 2 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase, catabolic (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3L9 at UniProt or InterPro

Protein Sequence (371 amino acids)

>RR42_RS12035 alanine racemase (Cupriavidus basilensis FW507-4G11)
MPRPIHAVIHQPALANNLDVVRRCAPQSRVWAVIKANAYGHGIRRAFAGLRAADGFGLLD
LNEAVLLRELGWQGPILLLEGFFQPQDVPLLEQYRLTTAVHCEEQLRMLEVARPKGPLGI
QLKLNTGMNRLGFRPEQYRTAWERARTLPCVGSIVHMTHFSDADSARGIAHQLEVFDATT
ANLPGEASLSNSAATLWHPQAHRAWVRPGVVLYGASPTGVAADVASFGLQPAMSLHSELI
SVQDLQPGDTVGYGSLFTAERPMRIGVVACGYADGYPRHAAGWGDKPAPVLVDGVRTRLV
GRVSMDMICVDLTPCPRAKVGSAVTLWGQGLPIDDVAVASGTVGYELMCALAPRVPVTVA
TLTTPEQSALA