Protein Info for RR42_RS12010 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 PF00005: ABC_tran" amino acids 18 to 178 (161 residues), 82.2 bits, see alignment E=2e-26 amino acids 335 to 466 (132 residues), 78.5 bits, see alignment E=2.7e-25 PF12848: ABC_tran_Xtn" amino acids 217 to 292 (76 residues), 100.3 bits, see alignment E=1.8e-32 PF16326: ABC_tran_CTD" amino acids 576 to 640 (65 residues), 38.4 bits, see alignment E=4.1e-13

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 89% identity to reu:Reut_A1930)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3L5 at UniProt or InterPro

Protein Sequence (646 amino acids)

>RR42_RS12010 ABC transporter (Cupriavidus basilensis FW507-4G11)
MIRIDQLVLQRGTKVLFDHTSVTLNPGERVGLVGANGSGKSTLFAMLRGELQADGGDVAI
PPQWRTAHVAQETPAVMRSAVDYTIDGDTRLRDIEARIAAAQASGDGSAEGDAHGAFADA
DGYTAPARAQALLLGLGFTLAQVSQPVASFSGGWRMRLNLAQALMCPSDLLLLDEPTNHL
DLDAIVWLEDWLARYPGTLVMISHDREFLDAICNVTVHIENQQLRRYGGNYSQFETLRLQ
QMALQQSAYSRQQKEIAHLESFITRFKAKATKARQAQSRVKALEKMERLAPVHIAAGFAF
EFREPDSAPNPMMVLEGVDCGYPAPAPDAPPVTILHNLTLSIQTGQRIGLLGANGQGKST
LVKTLAGTQQALSGTLRQGKGLQIGYFAQHQLETLRDHESPLQHLARLAPDTREQELRDF
LGSFNFRGEMATASIEPFSGGEKARLALALIVWQKPNLLLLDEPTNHLDLDTREALTMAL
AQFEGTLIVVSHDRHLLRATTDQFLLVADGTIQPFDGDLDDYRDWLLKQAAAKRNAATAA
HAQEDGEAPATANRRDQRRAEADERQRLTQLRKPLAKELEKVEKRMAVLQQAKSEIDTFM
ADETSYAEANKAKLLEMLKRQGEVGGELDTLEERWLELQEQIELIV