Protein Info for RR42_RS11935 in Cupriavidus basilensis FW507-4G11

Annotation: 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF14805: THDPS_N_2" amino acids 5 to 70 (66 residues), 94.5 bits, see alignment E=5.3e-31 TIGR00965: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase" amino acids 5 to 274 (270 residues), 484.5 bits, see alignment E=4.5e-150 PF14602: Hexapep_2" amino acids 177 to 211 (35 residues), 53.7 bits, see alignment 2.1e-18 PF00132: Hexapep" amino acids 178 to 211 (34 residues), 30.4 bits, see alignment 3.4e-11

Best Hits

Swiss-Prot: 98% identical to DAPD_CUPNH: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 96% identity to rme:Rmet_1423)

MetaCyc: 75% identical to tetrahydrodipicolinate succinylase (Escherichia coli K-12 substr. MG1655)
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. [EC: 2.3.1.117]

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3K7 at UniProt or InterPro

Protein Sequence (275 amino acids)

>RR42_RS11935 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (Cupriavidus basilensis FW507-4G11)
MTQALQALIDQAWEDRASLSPKSAPNDIREAVANVIGQLDTGALRVAEKQGKEWIVNQWI
KKAVLLSFRLEDNAPMSAGGFAQFYDKVPTKFANWTADDFAKGGFRVVPPAVARRGSFIA
KNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVII
EDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEIHYGRVPAGSVVVAGNL
PSKDGKYSLYCAVIVKKVDAQTRAKTSLNDLLRGD