Protein Info for RR42_RS11775 in Cupriavidus basilensis FW507-4G11

Annotation: single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01668: SmpB
  • amino acids 3 to 145 (143 residues), 196.9 bits, E=7.5e-63
• TIGR00086: SsrA-binding protein
  • amino acids 3 to 145 (143 residues), 176.4 bits, E=1.8e-56

Best Hits

Swiss-Prot: 90% identical to SSRP_CUPNH: SsrA-binding protein (smpB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03664, SsrA-binding protein (inferred from 91% identity to cti:RALTA_A1671)

Predicted SEED Role

"tmRNA-binding protein SmpB" in subsystem Heat shock dnaK gene cluster extended or Staphylococcal pathogenicity islands SaPI or Trans-translation by stalled ribosomes

Sequence Analysis Tools

See A0A0C4Y9Z8 at UniProt or InterPro

Protein Sequence (150 amino acids)

>RR42_RS11775 single-stranded DNA-binding protein (Cupriavidus basilensis FW507-4G11)
MTIAENKKAFFDYFIEERYEAGIVLEGWEVKAIRAGRVQIKEGYVVIRDAELFLIGAHIS
PLHSASTHVSPDAVRTRKLLLKAEEIKRLIGKVEQRGFTIVPLNLHYTRGRVKCEIGLAK
GKKLFDKRETEKDRDWQREKARIMKGAGKE