Protein Info for RR42_RS11770 in Cupriavidus basilensis FW507-4G11

Annotation: cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF10604: Polyketide_cyc2" amino acids 1 to 137 (137 residues), 37.7 bits, see alignment E=2.5e-13 PF03364: Polyketide_cyc" amino acids 11 to 134 (124 residues), 131.7 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 44% identical to PAST_ECOL6: Persistence and stress-resistance toxin PasT (pasT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 90% identity to cti:RALTA_A1670)

Predicted SEED Role

"Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YC85 at UniProt or InterPro

Protein Sequence (145 amino acids)

>RR42_RS11770 cyclase (Cupriavidus basilensis FW507-4G11)
MADVHKSVLLGHSAEQMYNLVTQVEDYPKFLPWCGGVEVFEQTETMLDAKIYIHFNGIKQ
YFHTRNTQERPTRIDMVFEDGPFKTFSGSWRFTPLREDACKIEFHLHYEFSSFLLEKIIG
PVFSMIANTFVDAFVKRAEMVYGNG