Protein Info for RR42_RS11740 in Cupriavidus basilensis FW507-4G11

Annotation: GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 199 (195 residues), 234.4 bits, E=6.8e-74
• PF00117: GATase
  • amino acids 6 to 195 (190 residues), 130.4 bits, E=1.7e-41
• PF07722: Peptidase_C26
  • amino acids 68 to 178 (111 residues), 43.8 bits, E=6.6e-15
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 209 to 539 (331 residues), 463.8 bits, E=2.7e-143
• PF02540: NAD_synthase
  • amino acids 211 to 249 (39 residues), 28.5 bits, 2.1e-10
• PF00958: GMP_synt_C
  • amino acids 453 to 538 (86 residues), 136.4 bits, E=7.1e-44

Best Hits

Swiss-Prot: 94% identical to GUAA_CUPNH: GMP synthase [glutamine-hydrolyzing] (guaA) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 92% identity to bam:Bamb_2022)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See A0A0C4YA16 at UniProt or InterPro

Protein Sequence (539 amino acids)

>RR42_RS11740 GMP synthase (Cupriavidus basilensis FW507-4G11)
MHDKVLILDFGSQVTQLIARRVREAHVYCEIHPNDVTDEFVREFAPKGIILSGSHASTYE
DHQLRAPQAVWDLGVPVLGICYGMQTMAVQLGGKVEWSDHREFGYAEMRAHGHTALLKDL
EDFSTPEGHGMLKVWMSHGDKVAELPPGFKLMASTPSCPIAAMADEARGYYAVQFHPEVT
HTAKGRDILERFVLKIAGAKPDWVMHDHITEAVAKIREQVGDEEVILGLSGGVDSSVAAA
LIHRAIGDQLTCVFVDHGLLRLNEGKMVMDMFAGRLHAKVIAIDASEQFLGHLAGVTDPE
QKRKIIGREFVEVFQAEAKKLTNAKWLAQGTIYPDVVESGGTKTKKATTIKSHHNVGGLP
ETLGLKLLEPLRDLFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRILGEVKRDYAELLR
RADAIFIEELRGTVATEQDAAAGMCEPSQVGKSWYDLTSQAFAVFLPVKSVGVMGDGRTY
DYVVALRAVQTTDFMTAHWAHLPYALLGRCSNRIINEVRGLNRVVYDVSGKPPATIEWE