Protein Info for RR42_RS11670 in Cupriavidus basilensis FW507-4G11

Annotation: thymidine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 TIGR02645: putative thymidine phosphorylase" amino acids 12 to 504 (493 residues), 642.7 bits, see alignment E=1.6e-197 PF02885: Glycos_trans_3N" amino acids 106 to 166 (61 residues), 44.7 bits, see alignment E=1.4e-15 PF00591: Glycos_transf_3" amino acids 176 to 271 (96 residues), 29.4 bits, see alignment E=9.6e-11 PF07831: PYNP_C" amino acids 436 to 495 (60 residues), 39.4 bits, see alignment E=5.8e-14

Best Hits

Swiss-Prot: 69% identical to TYPH_RALSO: Putative thymidine phosphorylase (RSc0204) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00758, thymidine phosphorylase [EC: 2.4.2.4] (inferred from 69% identity to rso:RSc0204)

Predicted SEED Role

"Thymidine phosphorylase (EC 2.4.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 2.4.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.4

Use Curated BLAST to search for 2.4.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y3H1 at UniProt or InterPro

Protein Sequence (510 amino acids)

>RR42_RS11670 thymidine phosphorylase (Cupriavidus basilensis FW507-4G11)
MHTQTQAAAETLTFKPLEIDTYQEHVIYMHRDCVVCHAEGFSAQTRVQVSTGAGAQSLIA
TLNVVGDALLAPSQVGLSSGASQQLGVAAGDIIAVTHAPGLESLRAVRSKIHGNPLDAPQ
LCAIMGDISAGRYSDVHIAAFLSACAGGRMTTQETVDLTCAMLDTGDRLDWDRPVVADKH
CVGGLPGNRTSPIVVAICAAAGLLLPKTSSRAITSPAGTADTMEVLTRVTLSAAEMRRVV
ERVGAALVWGGSLTLSPADDVLIRVERALEIDSDAQLVASVLSKKLAAGSTHVLIDVPLG
PTAKVRTDADLARLRLLLEEVARAFGMHVLVVHTDGSQPVGRGIGPALEARDVLAVLQGA
ESAPADLRGRALLLSASLMEFCGAVPAGQGLALATRLLADGAAWAKFQAICEAQGGLRQP
GSAPLRREILAPADGIVTSIDNRLLSRAAKLAGAPNRKAAGIDMHVRLNDAVRAGQPLFT
IHALAQGELAYSQNFLTTHPAINIGTTEQR