Protein Info for RR42_RS11505 in Cupriavidus basilensis FW507-4G11

Annotation: multidrug ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 9 to 262 (254 residues), 356.8 bits, see alignment E=3.6e-111 PF01061: ABC2_membrane" amino acids 11 to 230 (220 residues), 96.7 bits, see alignment E=2.2e-31 PF12698: ABC2_membrane_3" amino acids 60 to 255 (196 residues), 61.9 bits, see alignment E=9.3e-21 PF12679: ABC2_membrane_2" amino acids 73 to 255 (183 residues), 27.9 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 85% identity to reh:H16_B1044)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9U5 at UniProt or InterPro

Protein Sequence (274 amino acids)

>RR42_RS11505 multidrug ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MTTTLIHAWRALRAVAGRELHKFFRQPGRLFSSLVRPLLWLLVFAAGFQNALGVAIVPPY
DTYVEYKVFVTPGLLGMIALFNGMQSSLAMVYDREMGVMRLLLTAPLPRAWLLACKLAAG
TLLSLLQMLAFLLVAMAFDVTFAPACLPGALAVMVLAALMLGALGLLLSVHVRQLENFAG
TMNFVIFPMFFISSALYPLWKLEESGATVVYQLARFNPFTHAVEAIRFALYGQAAPVSLA
VVAGCTAVFFALALLGYDPQRGVARRVRQAGGAA