Protein Info for RR42_RS11385 in Cupriavidus basilensis FW507-4G11

Annotation: 6-carboxy-5,6,7,8-tetrahydropterin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 7 to 120 (114 residues), 90.1 bits, E=5e-30
• PF01242: PTPS
  • amino acids 7 to 149 (143 residues), 100.4 bits, E=3.6e-33

Best Hits

Swiss-Prot: 35% identical to QUED_RICFE: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 90% identity to cti:RALTA_A1614)

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

See A0A0C4Y9U6 at UniProt or InterPro

Protein Sequence (158 amino acids)

>RR42_RS11385 6-carboxy-5,6,7,8-tetrahydropterin synthase (Cupriavidus basilensis FW507-4G11)
MNKQVSITRRLEFDSGHRIPNHGGQCRNIHGHRYRLDLTLSGEVLHRAGASDEGMILDFS
DIKALATEHLVSKWDHAFLIHRGDTALLNFLQTMDGHKTVVLDAIPTVENLAQIAFDMLA
PVFKDCFGHQLQLTRLVLFETPNCWAEVSAAFSLPAQD