Protein Info for RR42_RS11195 in Cupriavidus basilensis FW507-4G11

Annotation: phosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 161 to 179 (19 residues), see Phobius details PF11871: DUF3391" amino acids 2 to 129 (128 residues), 104.4 bits, see alignment E=1.1e-33 PF13487: HD_5" amino acids 154 to 315 (162 residues), 113.7 bits, see alignment E=1.3e-36 PF01966: HD" amino acids 162 to 283 (122 residues), 47.8 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: None (inferred from 63% identity to cti:RALTA_A1595)

Predicted SEED Role

"HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBX5 at UniProt or InterPro

Protein Sequence (403 amino acids)

>RR42_RS11195 phosphohydrolase (Cupriavidus basilensis FW507-4G11)
MLKRIKTQQLQVGMFVARVGGAWLEHPFWRSRFLVNNQEQIDQMIASKVEEVWIDLLKGK
GVPPPVQLAASGSLSVKPVADEPAGAVPQSGVPLEVEFGLAREVMKNGKAVVGSMFTNAR
MGRALEVEGALMLVDSVSNSLTRHSQALIALARLKVRDDYTYLHSFAVCALMIALGRTLG
LDNAAVQQLGLAGLVHDIGKISVPTHVLHKQGEMTAAEVAMVQRHPSVGYRVLNEAKLYS
NIPLDVCMHHHERIDGRGYPFGLHGNEISVHAKIAAVCDAYDSLTSNRPGHQAWTPARAL
EYMAVRVDTLFDRTVFQAFTRSIGIYPLGTVLRLRSGRLAVVFAQNDNEPLRPQVKVFYS
VSEAARLGPETLDLRETEDTVAGFEDPAQWGFRDEQLLELCAA