Protein Info for RR42_RS11180 in Cupriavidus basilensis FW507-4G11

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13145: Rotamase_2" amino acids 110 to 233 (124 residues), 74 bits, see alignment E=2.8e-24 PF13616: Rotamase_3" amino acids 130 to 220 (91 residues), 81.7 bits, see alignment E=9.1e-27 PF00639: Rotamase" amino acids 141 to 219 (79 residues), 75 bits, see alignment E=1.2e-24

Best Hits

Swiss-Prot: 45% identical to PLP1_BORBR: Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BB3803) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 92% identity to reu:Reut_A1392)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG74 at UniProt or InterPro

Protein Sequence (264 amino acids)

>RR42_RS11180 peptidylprolyl isomerase (Cupriavidus basilensis FW507-4G11)
MKTTVLSFSLAAVLAAGSLPALAQNAAVVNGKAIPSAKLDKLVAGTGQPPSAELRDRART
MLIDRELLLQEANKRGLTQRDDLQEQLEQAKLNVLAGAVFEDYVKTHGASDDELRKQYDK
IKTQFGSGKEYHARHILVEKEADARAIIAKIKAGAKFEDMAKASSKDPGSAANGGDLDWA
NSSSYVPEFSAAMTALKKGQMTETPVKTQFGWHIIQLDDTRDAKIPTFEEVKPQLVQMLM
GDQNWQREQFQAMMKSLKDKAKIQ