Protein Info for RR42_RS11145 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 105 (17 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details amino acids 245 to 247 (3 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 257 (250 residues), 113.9 bits, see alignment E=3.8e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 94% identity to rme:Rmet_1861)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y9N4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>RR42_RS11145 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MEFFVISLLNGVSYGLLLFMLSSGLTLIFSMMGVLNFAHASFYMLGAYFAYTIASKIGFW
PALIFAPLLVAGAGALVERFGLRTVHKYGHVAELLFTFGLAYLIEEGVKLVWGLAAVPYR
IPAELDGPLFTVFTSSFPKYRAFMMLVSLAMLVAIYLVLTRTRIGLVIQAALTHPEMVEA
LGHNVPRVFMMVFGGGAALAGLAGVIGGNAFITEPSMAAAVGSIIFVVAVVGGMGSLVGA
FIASLLIGVLQTFAVTLDASLAGLLGSIGLQVTDSTPLSSLWKLTVAQVAPVLPYLLLVV
MLIFRPRGLMGTREG