Protein Info for RR42_RS10985 in Cupriavidus basilensis FW507-4G11

Annotation: NAD-dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 169 (169 residues), 48.1 bits, see alignment E=2.7e-16 PF01370: Epimerase" amino acids 3 to 204 (202 residues), 88.7 bits, see alignment E=1.2e-28 PF02719: Polysacc_synt_2" amino acids 3 to 169 (167 residues), 23 bits, see alignment E=1.2e-08 PF16363: GDP_Man_Dehyd" amino acids 4 to 169 (166 residues), 70.4 bits, see alignment E=6e-23 PF01073: 3Beta_HSD" amino acids 4 to 187 (184 residues), 56.5 bits, see alignment E=7e-19 PF07993: NAD_binding_4" amino acids 51 to 188 (138 residues), 31.3 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 83% identical to DEND_CUPNH: D-erythronate dehydrogenase (denD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 83% identity to reh:H16_A1557)

MetaCyc: 49% identical to D-erythronate 2-dehydrogenase (Haemophilus influenzae Rd KW20)
RXN-18591 [EC: 1.1.1.410]

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.410 or 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG00 at UniProt or InterPro

Protein Sequence (329 amino acids)

>RR42_RS10985 NAD-dependent epimerase (Cupriavidus basilensis FW507-4G11)
MQVLITGGAGFLGLQLARQLLKRGTLDIDGKPVAIAGLTLLDVVAPPALNDARVRVVTGD
LSDPAVLAQAVDEHTSAVFHLAAVVSGQAEADFDLGMRVNLDAARALLETCRALHVKHGS
RPRVVFTSSVAVYGGTLPAVVQDDTALNPQSSYGAQKAIGELLLSDYSRRGFVDGRVLRL
PTISVRPGKPNAAASSFASGIIREPLAGVAANCPVAPETPLWLLSPRGAIAALARGMEID
GAKLGERRTVNLPGLSVTPKEMVAALRRVAGDAVADRVSWEREARIENIVGTWPAAWNTE
RALALGFQGDEDFDAVIRAYIEDAGIAAR