Protein Info for RR42_RS10975 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 380 to 405 (26 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 402 (367 residues), 166.7 bits, see alignment E=7.3e-53 PF00083: Sugar_tr" amino acids 64 to 435 (372 residues), 42.5 bits, see alignment E=4.2e-15

Best Hits

Swiss-Prot: 48% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 86% identity to reu:Reut_A1424)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBP2 at UniProt or InterPro

Protein Sequence (443 amino acids)

>RR42_RS10975 MFS transporter (Cupriavidus basilensis FW507-4G11)
MHTSTKAALAGAGQDIDRDIEKRAYSKVFWRIMPFLMLCYVIAYLDRVNVGFAKLQMAQD
LAFSETVFGLGAGLFFIGYFLFEVPSNLLMHKLGARVWIARIMITWGIISALFVFVKTPT
TFYIMRFLLGLAEAGFYPGVILYLTYWYPANRRAKMIALFMSGIPVAGMLGNPLSGWIMD
AFHDYGGMRGWQWMFLIEALPALLIGIVTVFVLKNGIDQAPWLDANEKRVLKRNIEEDAR
QAGASGTGHSLGAVFKDSRVWWMCMIYFCFVTGQYALTFWMPTLVKTSGVTGNLNIGLLS
AIPFICAIVVMNFLGHSADARRERRWHLIVPALMGAVGFAIAASFTHNTVVAIAALSLAA
AGVLTCAPLFWSLPTAFLSGLAAASGIAVVNSVGNLAGFVAPYMVGYLTDLTHSTQSSMY
VLSGMLVLGAGLVWLTPAKLVNR