Protein Info for RR42_RS10905 in Cupriavidus basilensis FW507-4G11

Annotation: thymidylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00041: dTMP kinase
  • amino acids 2 to 194 (193 residues), 169.6 bits, E=3.3e-54
• PF02223: Thymidylate_kin
  • amino acids 8 to 194 (187 residues), 161.8 bits, E=7.6e-52

Best Hits

Swiss-Prot: 88% identical to KTHY_CUPMC: Thymidylate kinase (tmk) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 88% identity to rme:Rmet_1828)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

See A0A0C4YFX8 at UniProt or InterPro

Protein Sequence (204 amino acids)

>RR42_RS10905 thymidylate kinase (Cupriavidus basilensis FW507-4G11)
MRGKFITFEGIDGAGKSTHVEWVADRLRARLAGHASVVTTREPGGTPLGEDLRQLLLHRK
MHLETEALLMFAARREHIAEVIEPALTRGDWVVSDRFTDATFAYQGGGRGLPRARLEVLE
TWVQDGLQPDLTLLFDVPLETASARLAGAREPDKFEAESRAFFERTRQEYLRRAAESAQR
FRVIDATRSIPEIQVELEKILATL