Protein Info for RR42_RS10895 in Cupriavidus basilensis FW507-4G11

Annotation: pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF07238: PilZ" amino acids 21 to 111 (91 residues), 42.2 bits, see alignment E=4.3e-15

Best Hits

KEGG orthology group: K02676, type IV pilus assembly protein PilZ (inferred from 86% identity to cti:RALTA_A1497)

Predicted SEED Role

"Type IV pilus biogenesis protein PilZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YBM6 at UniProt or InterPro

Protein Sequence (127 amino acids)

>RR42_RS10895 pilus assembly protein (Cupriavidus basilensis FW507-4G11)
MAAAGGIGAPTVPGAASRPNVLSLSIKDQAGLYAAYMPFLHRGGIFVPSNRPFRLGEQVF
LVLSLVDRPQKYQIAGHVAWITPVGTPNKTPGIGIHLPDDDNGRNLRRAVEEILGKTIES
GRPSQTL