Protein Info for RR42_RS10665 in Cupriavidus basilensis FW507-4G11

Annotation: branched-chain alpha-keto acid dehydrogenase subunit E2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF00364: Biotin_lipoyl" amino acids 3 to 74 (72 residues), 55.5 bits, see alignment E=6.2e-19 PF02817: E3_binding" amino acids 116 to 149 (34 residues), 30.9 bits, see alignment 3.8e-11 PF00198: 2-oxoacid_dh" amino acids 164 to 382 (219 residues), 191 bits, see alignment E=3.5e-60

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 68% identity to rpi:Rpic_4647)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC 2.3.1.-)" in subsystem Acetoin, butanediol metabolism (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.12

Use Curated BLAST to search for 2.3.1.- or 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YFP6 at UniProt or InterPro

Protein Sequence (384 amino acids)

>RR42_RS10665 branched-chain alpha-keto acid dehydrogenase subunit E2 (Cupriavidus basilensis FW507-4G11)
MIEFRLPALGADMDEGTLLEWTVKPGDPLKRGQVVAVVDTSKAAVEVECWHEGTVAELIV
TPGAKIPVGTLMAVFLEPGETPGAARPATGPADAPAPSAAHGLPGIAMAPPTRHMVSPAA
RKSALELGIDIDAVFATDPNGIVKLADVERAVRERAAAPVDKSAGIRKAIAVAMARSKRE
IPHYYVGETIPLGATLAWLTRENANRPMAERLLPAALLIKAVAVTLKNYPELNGFFRDEV
FHAVSQVHVGVAISLRQGGLIAPALLDADTKPLTLLMRELSDLVKRCRAGSLRSSEMAMP
TITVTNLGDQGAEAVFGVIYPPQVALVGIGRVIERPWAENGELKVVPAVTASLSADHRVS
DGHRGALFLVELRELLQHPEELNQ