Protein Info for RR42_RS10140 in Cupriavidus basilensis FW507-4G11

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 116 to 132 (17 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details TIGR00858: 8-amino-7-oxononanoate synthase" amino acids 22 to 397 (376 residues), 439.2 bits, see alignment E=4.7e-136 PF00155: Aminotran_1_2" amino acids 45 to 395 (351 residues), 178.7 bits, see alignment E=1e-56

Best Hits

Swiss-Prot: 74% identical to BIOF_CUPNH: 8-amino-7-oxononanoate synthase (bioF) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 74% identity to reh:H16_A0181)

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.47

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y2P9 at UniProt or InterPro

Protein Sequence (407 amino acids)

>RR42_RS10140 8-amino-7-oxononanoate synthase (Cupriavidus basilensis FW507-4G11)
MLLDRLTQAAAERAERAMTRRRRVTHTACAPHQEVSHGCGEPRTLLSFCSNDYLGLANHP
TVISAFAEGAYRYGAGSGASHVVNGHSLAHDHLENELARWLDSHIPGAQALYFCSGYMAN
MAVLSALGTAGATLFCDKLNHASLIDGALLARAHVKRYPHGNTTALARLLAGSDSPLKLI
VTDSVFSMDGDIAPLVELLALAERHDAWIVVDDAHGFGVLGESGRGVLEHLALASERFIY
IGTLGKAAGVAGAFVAAHATIVEHLVNVARPYIYTTAAPPAAAHALLASLALIAGAEGRR
RRAHVAQLIGQLRAGLETLLACHAEAGWQLADSDTPIQPLIVGGNAAAMALSAALEADGI
RVTAIRPPTVPEGTARLRIALSAAHTAGDIARLLDCLSAIVAQREAA