Protein Info for RR42_RS09930 in Cupriavidus basilensis FW507-4G11

Annotation: plasmid stability protein StbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details PF01850: PIN" amino acids 2 to 123 (122 residues), 62.5 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 56% identical to Y4JK_SINFN: VapC ribonuclease Y4jK (NGR_a03040) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07062, (no description) (inferred from 85% identity to pna:Pnap_4764)

Predicted SEED Role

"VapC toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y2L8 at UniProt or InterPro

Protein Sequence (138 amino acids)

>RR42_RS09930 plasmid stability protein StbB (Cupriavidus basilensis FW507-4G11)
MIVLDTNVVSEAMKPESHPAVRAWLDNQAAETLYLSSVTVAELLFGIAALPAGKRKNMLT
EAVDGLLALFRDRVLPFDTDAARHYAELAMLARTSGRGFPTPDGYIAAIAASRGFIVASR
DAAPYTAAGVTVINPWEV