Protein Info for RR42_RS09620 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 118 (31 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 394 to 418 (25 residues), see Phobius details PF02308: MgtC" amino acids 10 to 118 (109 residues), 47.8 bits, see alignment E=1.8e-16 PF13194: DUF4010" amino acids 176 to 388 (213 residues), 146.1 bits, see alignment E=1.2e-46

Best Hits

KEGG orthology group: None (inferred from 52% identity to rpf:Rpic12D_4569)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAQ5 at UniProt or InterPro

Protein Sequence (419 amino acids)

>RR42_RS09620 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MDHTVVAFSVALGIGLAIGLERERSQAADGGEAPAGLRTFAIASVSGALGAFLPNAGLLP
AVLLAIAGLAALGYRHTAAGDPGMTTEIALLCTVLLGALAVTHPALAAGIATVLAILLHG
KATLHGLVRNALSRQELSDALMLAVAALVIWPLLPDRYMGPFDAWNPRTLWLVAMLVMLM
GAAGHIATRLFGERVGLPVTGLFGGFVSSAATIGSMAVMVRRTPGLRDAAVAAALLSSVA
TFVQMLLLLAATSAAALRPLALPLAAGLTAMGLYAGVWLWLAARRPAVRDGAQDGAQLAG
RSLDWRVAAGFVLLMALLLLVNGATRASSGAGMLMVVAVAGGFADAHAATVSVAAQVAAG
RMPAEAAVWPVLAAFSANTATKIVLAAAGGRAFALRVGAGLVLAGAVTWAAALALAWLR