Protein Info for RR42_RS09610 in Cupriavidus basilensis FW507-4G11

Annotation: mRNA 3'-end processing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF00753: Lactamase_B" amino acids 17 to 75 (59 residues), 40.4 bits, see alignment E=8.3e-14 PF16661: Lactamase_B_6" amino acids 20 to 197 (178 residues), 28.1 bits, see alignment E=3.3e-10 PF12706: Lactamase_B_2" amino acids 25 to 212 (188 residues), 35.3 bits, see alignment E=2.4e-12 PF10996: Beta-Casp" amino acids 247 to 366 (120 residues), 114.6 bits, see alignment E=9.9e-37 PF07521: RMMBL" amino acids 380 to 443 (64 residues), 58.4 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 80% identity to reh:H16_A2022)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YEZ1 at UniProt or InterPro

Protein Sequence (452 amino acids)

>RR42_RS09610 mRNA 3'-end processing factor (Cupriavidus basilensis FW507-4G11)
MQLQFLGATDTVTGSKYVLDTGRSRVMVDCGLFQGYKALRLRNWDRLPVDPSTLDAVVLT
HAHIDHSGYLPLLVRNGFRGRVFCTMGTAQLCQILLPDSAHLAQEDAHYANRKGYSRHQP
ALPLYDGADAVRALRRLDPFHYDTRVRVTPDVEAEFHRAGHIIGSAIVTLHVDGKRIVFS
GDLGRQQDIVMRPPEILREADHLLVESTYGDRAHPADDPLDTLGEVVSRTIGRGGSVVIP
AFAVGRTQALLYCLYKLREQNRIPQVPIYLNSPMAIDATTIFALHPDELRIDRTACAAAC
HIAVLVQSMQQSMWLNRDRAPKIILAGSGMATGGRVVHHLETYGQDARNTILLSGFQAAG
TRGAALASGMRELRIHGKQVAIQASVEQITSLSAHADAGELMTWLGGFGSAPRQTFVVHG
EPAASDALRQRIERELRWAVTMPEYLRSYALD