Protein Info for RR42_RS09180 in Cupriavidus basilensis FW507-4G11

Annotation: Rrf2 family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR00738: Rrf2 family protein" amino acids 1 to 131 (131 residues), 116.1 bits, see alignment E=5.2e-38 PF02082: Rrf2" amino acids 3 to 132 (130 residues), 129.2 bits, see alignment E=5.6e-42

Best Hits

Swiss-Prot: 44% identical to NSRR_OCEIH: HTH-type transcriptional regulator NsrR (nsrR) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 80% identity to rsl:RPSI07_0043)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAG3 at UniProt or InterPro

Protein Sequence (174 amino acids)

>RR42_RS09180 Rrf2 family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MRLTDYTDYSLRTLIYVAVHPGELVTIQHIADAFGIPKNHLIKIVQKLGQAGFLHTVRGR
AGGIALGRPASEVNLGEVIRTMESDFNLVECFQGDDNHCIITRVCGLRGVLSAALRAYFE
VLDAYSLQDLVEKPAALTRAFGDGGAATLAAIPVKNVTRKAKASKATAEDAGEQ