Protein Info for RR42_RS09155 in Cupriavidus basilensis FW507-4G11

Annotation: thioredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 171 to 197 (27 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 15 to 203 (189 residues), 85 bits, see alignment E=2.9e-28

Best Hits

Swiss-Prot: 46% identical to YEDZ1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedZ1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 75% identity to bxe:Bxe_B1751)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAF8 at UniProt or InterPro

Protein Sequence (215 amino acids)

>RR42_RS09155 thioredoxin reductase (Cupriavidus basilensis FW507-4G11)
MRKLPSSAPARRAVVHPLVVRATHWINAFAMACMVMSGWAIYNASPLFSFKFPAWATVGG
WLGGSIAWHFAAMWLLAANGLVYLAYGLATRHFRRHFLPLSARGVLRDASLAIRLRLPHR
PGAYNAVQRLMYVAVLLLGVLVVASGLAIWKPVQLDWLATLFGGFDTARHVHFLAMAGIV
GFVVIHLALVILVPATLLPMLTGRAGRAGHGDVQA