Protein Info for RR42_RS08985 in Cupriavidus basilensis FW507-4G11

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 TIGR00229: PAS domain S-box protein" amino acids 116 to 245 (130 residues), 39.4 bits, see alignment E=6.1e-14 PF08447: PAS_3" amino acids 143 to 231 (89 residues), 84.6 bits, see alignment E=7e-28 amino acids 278 to 359 (82 residues), 38 bits, see alignment E=2.4e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 376 to 540 (165 residues), 155.9 bits, see alignment E=8.1e-50 PF00990: GGDEF" amino acids 380 to 538 (159 residues), 145.8 bits, see alignment E=1.6e-46

Best Hits

KEGG orthology group: None (inferred from 63% identity to har:HEAR0293)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y898 at UniProt or InterPro

Protein Sequence (542 amino acids)

>RR42_RS08985 diguanylate cyclase (Cupriavidus basilensis FW507-4G11)
MTVALQQARFDALTRLARHLFKVPVALVTLHDVLDDAHPGDVPILIDGLPMGFHAACPLT
TSSGSRLGAFWLLDAGSRELDQAERGLLQDFADMAVAIVERDLAQGKLNDDASRLEENEK
RLELAIAGSGTGVWDRDIQSGCIHYSAGWKAIIGYEESEITNRIEDSYTRVHPDDLAYVQ
ATIQAHFNQETESYAVDHRIRCKDGSYKWISSRGKVVSRGGNGEPLRMIGTTTDITAIQA
LAEELQQTVDLVTSLTNEVPGLVFQHRLLPTGESFLSYASAGIADIYELTPQQVAASTGP
IHAVIHPDDLEAYRASLHASAASLTPWHLEYRVELPRQGLRWRQGDARPRRLDDGSTLWH
GFITDATERKRIEGELQEFATIDFLTQLPNRRHFVVRIEQELARIQRTDGRPAAVLTFDL
DHFKAINDTWGHAMGDHALRCFAALLRDALQKHDFAGRIGGEEFAVVLPDASLETATRFA
RRVQHQIAETALLDGSQIVTLTVSVGIALMHATDLSADLSLLRSDGALYRAKERGRNRIE
CD