Protein Info for RR42_RS08910 in Cupriavidus basilensis FW507-4G11

Annotation: nitrate/nitrite transporter NarK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 40 to 435 (396 residues), 318.6 bits, see alignment E=2.7e-99 PF07690: MFS_1" amino acids 48 to 385 (338 residues), 50.8 bits, see alignment E=6.2e-18

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 84% identity to dia:Dtpsy_0426)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y268 at UniProt or InterPro

Protein Sequence (483 amino acids)

>RR42_RS08910 nitrate/nitrite transporter NarK (Cupriavidus basilensis FW507-4G11)
MSRTVADTPKPSGGGRVLTIWTPEDRAFWEREGEAIAKLNLWISVPALFLAFAIWQLWSV
VAVNLPQLGFRYSTNQLFWLAAAPALSGATLRIFYSFMVPLFGGRRWTAISTASLLIPAI
GIGIAVQDPTTSYPTMLLLALLCGLGGGNFSSSMANISFFFPKEHKGSALGVNAGLGNLG
VSVVQFLSPLIVTVGILGIFGGDPQTIVGKTGQVSQVWAQNAAYIWIPWIALASVAAWFF
MNDIADARASFAAQAAIFKRKHNWLMCLLYLGTFGSFIGFAAGFPLLIKSQFPDVNPLAY
AWLGPLLGALIRPVGGWLADRLGGASVTLWNFVVMALAVVGVLYFLPKGAGGYALSAGPA
QGSFTGFFLMFLVLFLTTGIGNGSTFRMIPVIFLNQKLREVEGAGDEAQARAIKDGNTEG
AAALGFAGALGAYGGFFIPKSYGTAIAATGGPEAALWIFIVFYLLCVVVTWWYYGRRGAE
MPC